Recombinant Human S Opsin Protein

Product Discontinued

Recombinant Human S Opsin Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (AAI56720.1) for Human S Opsin
  
  

  Source: Wheat Germ

  Amino Acid Sequence: MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: OPN1SW
• Purity: N/A

Applications/Dilutions

• Dilutions:
  • Functional
  • Immunoaffinity Purification
• Theoretical MW: 38.28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Preservative: No Preservative
• Purity: N/A

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S Opsin Protein

• BCPBlue cone photoreceptor pigmentBlue-sensitive opsin
• BOPshort-wave-sensitive opsin 1
• CBT
• opsin 1 (cone pigments), short-wave-sensitive
• s-opsin

Background

FUNCTION: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. May increase spectral sensitivity in dim light. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in cone photoreceptor cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: OPN1SW