SIRP gamma/CD172g Antibody - BSA Free

Western Blot: SIRP gamma/CD172g Antibody [NBP2-82342] - WB Suggested Anti-SIRPG Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SIRP gamma/CD172g Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SIRP gamma. Peptide sequence: ITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAART The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRPG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SIRP gamma/CD172g Antibody - BSA Free

• bA77C3.1
• CD172g antigen
• CD172g
• FLJ42230
• signal-regulatory protein beta 2
• Signal-regulatory protein beta-2
• signal-regulatory protein gamma
• SIRP beta 2
• SIRP gamma
• SIRP-B2
• SIRPB2CD172 antigen-like family member B
• SIRP-beta-2
• SIRPG
• SIRPgamma
• SIRP-gamma

Background

CD172 gamma is encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIRPG