Recombinant Human Sirtuin 3/SIRT3 Protein

Product Discontinued

Recombinant Human Sirtuin 3/SIRT3 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 297-399 of Human Sirtuin 3/SIRT3
  
  

  Source: Wheat Germ

  Amino Acid Sequence: PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: SIRT3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 37.07 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sirtuin 3/SIRT3 Protein

• EC 3.5.1
• EC 3.5.1.-
• hSIRT3
• mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase
• NAD-dependent deacetylase sirtuin-3, mitochondrial
• SIR2L3
• SIR2L3silent mating type information regulation 2, S.cerevisiae, homolog 3
• sir2-like 3
• SIR2-like protein 3
• SIRT3
• sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
• sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3
• Sirtuin 3
• sirtuin type 3

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SIRT3