TEAD4 Antibody (5H3) - Azide and BSA Free

Western Blot: TEAD4 Antibody (5H3) [H00007004-M01] - TEAD4 monoclonal antibody (M01), clone 5H3 Analysis of TEAD4 expression in HeLa.

Western Blot: TEAD4 Antibody (5H3) [H00007004-M01] - Analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi ( Cat # H00007004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TEAD4 monoclonal antibody (M01), clone 5H3 (Cat # H00007004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: TEAD4 Antibody (5H3) [H00007004-M01] - Analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01), clone 5H3.Lane 1: TEAD4 transfected lysate(34.2 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: TEAD4 Antibody (5H3) [H00007004-M01] - Analysis of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TEAD4 MaxPab rabbit polyclonal antibody.

ELISA: TEAD4 Antibody (5H3) [H00007004-M01] - Detection limit for recombinant GST tagged TEAD4 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IP, KD
• Clone: 5H3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TEAD4 Antibody (5H3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
• Specificity: TEAD4 - TEA domain family member 4
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TEAD4
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot
• Application Notes: This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 23195226).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23195226). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TEAD4 Antibody (5H3) - Azide and BSA Free

• EFTR-2
• hRTEF-1B
• related transcription enhancer factor 1B
• RTEF1RTEF-1
• TCF13L1MGC9014
• TEA domain family member 4TEF3
• TEAD-4
• TEF-3
• TEFR-1
• Transcription factor 13-like 1
• Transcription factor RTEF-1
• transcriptional enhancer factor 1-related
• transcriptional enhancer factor 3
• transcriptional enhancer factor TEF-3

Background

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TEAD4 Antibody (H00007004-M01)(6)

Publications using H00007004-M01

• Lim B, Kim HJ, Heo H et al. Epigenetic silencing of miR-1271 enhances MEK1 and TEAD4 expression in gastric cancer. Cancer Med 2018-06-04 [PMID: 29862663]
• Sun C, De Mello V, Mohamed A et al. Common and Distinctive Functions of the Hippo Effectors Taz and Yap in Skeletal Muscle Stem Cell Function. Stem Cells. 2017-06-07 [PMID: 28589555]
• Tanas MR, Ma S, Jadaan FO et al. Mechanism of action of a WWTR1(TAZ)-CAMTA1 fusion oncoprotein. Oncogene 2016-02-18 [PMID: 25961935] (WB)
• Lim Byungho, Park Jong-Lyul, Kim Hee-Jin et al. Integrative genomics analysis reveals the multilevel dysregulation and oncogenic characteristics of TEAD4 in gastric cancer. Carcinogenesis. 2014-05-01 [PMID: 24325916] (Human)
• O'Driscoll CM, Coulter JB, Bressler JP. Induction of a trophoblast-like phenotype by hydralazine in the p19 embryonic carcinoma cell line. Biochim Biophys Acta. 2013-03-01 [PMID: 23195226] (ICC/IF, Mouse)
• Benhaddou A, Keime C, Ye T et al. Transcription factor TEAD4 regulates expression of Myogenin and the unfolded protein response genes during C2C12 cell differentiation. Cell Death Differ. 2011-06-24 [PMID: 21701496]

Bioinformatics

• Gene Symbol: TEAD4
• Entrez:
  • 7004(Human)
• OMIM:
  • 601714(Human)
• Uniprot:
  • NP_003204(Human)