TMEM8C Antibody - Azide and BSA Free

Western Blot: TMEM8C Antibody [NBP2-94514] - Analysis of extracts of Mouse skeletal muscle, using TMEM8C at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

Product Discontinued

TMEM8C Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 120-221 of human TMEM8C (NP_001073952.1). GPIGTAILIIAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAKLDCSTLCCACV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYMK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500-1:2000
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TMEM8C Antibody - Azide and BSA Free

• MYOMAKER
• TMEM226
• Transmembrane Protein 226
• Transmembrane Protein 8C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for TMEM8C Antibody (NBP2-94514)(1)

Publication using NBP2-94514

• Palma-Flores C, Cano-Martínez LJ, Fernández-Valverde F et al. Differential histological features and myogenic protein levels in distinct muscles of d-sarcoglycan null muscular dystrophy mouse model Journal of molecular histology 2023-06-26 [PMID: 37358754] (WB)

Bioinformatics

• Gene Symbol: MYMK