VMAT2 Recombinant Protein Antigen

Images

 
There are currently no images for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VMAT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VMAT2.

Source: E. coli

Amino Acid Sequence: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC18A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68952.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VMAT2 Recombinant Protein Antigen

  • MGC120477
  • MNAT
  • monoamine neurotransmitter transporter
  • Monoamine transporter
  • SLC18A2
  • solute carrier family 18 (vesicular monoamine), member 2
  • Solute carrier family 18 member 2
  • SVAT
  • SVMT
  • SVMTMGC120478
  • synaptic vesicular amine transporter
  • VAT2
  • VAT2MGC26538
  • vesicle monoamine transporter type 2
  • vesicle monoamine/H+ antiporter
  • Vesicular amine transporter 2
  • VMAT2

Background

VMAT2 (Vesicular amine transporter 2) acts to accumulate cytosolic monoamines into synaptic vesicles. Its function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders such as dementia with Lewy bodies. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-58895
Species: Hu
Applications: IHC,  IHC-P
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
AF3564
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
212-GD
Species: Hu
Applications: Bind, BA
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-20857
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP) (0)

There are no publications for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP) (0)

There are no reviews for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VMAT2 Products

Research Areas for VMAT2 Recombinant Protein Antigen (NBP2-68952PEP)

Find related products by research area.

Blogs on VMAT2

There are no specific blogs for VMAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VMAT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC18A2