WSB2 Antibody - BSA Free

Western Blot: WSB2 Antibody [NBP2-86387] - Host: Rabbit. Target Name: WSB2. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WSB2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WSB2. Peptide sequence: LIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WSB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WSB2 Antibody - BSA Free

• CS box-containing WD protein
• MGC10210
• SBA2
• WD repeat and SOCS box containing 2
• WD repeat and SOCS box containing protein 2
• WD repeat and SOCS box-containing 2
• WD repeat and SOCS box-containing protein 2
• WSB-2

Background

WSB2 - WD repeat and SOCS box-containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WSB2