WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01A), clone 1A7.Lane 1: WWP1 transfected lysate(105.2 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of monoclonal antibody to WWP1 on A-431 cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of monoclonal antibody to WWP1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml.

Western Blot: WWP1 Antibody (1A7) [H00011059-M01] - WWP1 expression in A-431 ( Cat # L015V1 ).

Immunoprecipitation: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of WWP1 transfected lysate using anti-WWP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with WWP1 MaxPab rabbit polyclonal antibody.

ELISA: WWP1 Antibody (1A7) [H00011059-M01] - Detection limit for recombinant GST tagged WWP1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu, Pm
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 1A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WWP1 Antibody (1A7) - Azide and BSA Free Summary

• Immunogen: WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
• Specificity: WWP1 - WW domain containing E3 ubiquitin protein ligase 1 (1A7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: WWP1
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 10ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 3ug/mL
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Primate reactivity reported in scientific literature (PMID: 23573293).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WWP1 Antibody (1A7) - Azide and BSA Free

• AIP5
• AIP5Nedd-4-like ubiquitin-protein ligase
• atrophin-1 interacting protein 5
• Atrophin-1-interacting protein 5
• DKFZP434D2111
• EC 6.3.2
• EC 6.3.2.-
• HSDRP1
• NEDD4-like E3 ubiquitin-protein ligase WWP1
• TGIF-interacting ubiquitin ligase 1
• TIUL1
• Tiul11
• WW domain containing E3 ubiquitin protein ligase 1
• WW domain-containing protein 1
• WWP1

Background

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WWP1 Antibody (H00011059-M01)(20)

Publications using H00011059-M01

• Ross J S, Slodkowska E, Sheehan C E et al. Ww Domain Containing E3 Ubiquitin Protein Ligase 1 (Wwp1) Expression in Breast Cancer Its Correlation with Estrogen Receptor (Er) Insulin-like Growth Factor Receptor 1 (Igf-1r) Status. 44th Annual Meeting of the American Society of Clinical Oncology (ASCO); Chicago, IL; USA. 2008-05-30
• Kishikawa T, Higuchi H, Wang L et al. WWP1 inactivation enhances efficacy of PI3K inhibitors while suppressing their toxicities in breast cancer models The Journal of clinical investigation 2021-12-15 [PMID: 34907909] (WB, Human)
• Hwang D, Kim M, Kim S Et al. AMOTL2 mono-ubiquitination by WWP1 promotes contact inhibition by facilitating LATS activation Life science alliance 2021-10-01 [PMID: 34404733] (IP, WB)
• Novelli G, Liu J, Biancolella M et al. Inhibition of HECT E3 ligases as potential therapy for COVID-19 Cell death & disease 2021-03-24 [PMID: 33762578]
• Y Wu, J Qin, F Li, C Yang, Z Li, Z Zhou, H Zhang, Y Li, X Wang, R Liu, Q Tao, W Chen, C Chen USP3 promotes breast cancer cell proliferation by deubiquitinating KLF5 J. Biol. Chem., 2019-10-17;0(0):. 2019-10-17 [PMID: 31624151]
• CP Nielsen, KK Jernigan, NL Diggins, DJ Webb, JA MacGurn USP9X Deubiquitylates DVL2 to Regulate WNT Pathway Specification Cell Rep, 2019-07-23;28(4):1074-1089.e5. 2019-07-23 [PMID: 31340145]
• Lee YR, Chen M, Lee JD, Zhang J et al. Reactivation of PTEN tumor suppressor for cancer treatment through inhibition of a MYC-WWP1 inhibitory pathway Science 2019-05-17 [PMID: 31097636]
• Chen JJ, Zhang W., et al. High expression of WWP1 predicts poor prognosis and associates with tumor progression in human colorectal cancer. Am J Cancer Res 2018-02-01 [PMID: 29511596]
• Qin J, Zhou Z, Chen W et al. BAP1 promotes breast cancer cell proliferation and metastasis by deubiquitinating KLF5. Nat Commun 2015-01-01 [PMID: 26419610] (WB)
• Basheer WA, Harris BS, Mentrup HL et al. Cardiomyocyte-specific overexpression of the ubiquitin ligase Wwp1 contributes to reduction in connexin 43 and arrhythmogenesis. J Mol Cell Cardiol. 2015-09-16 [PMID: 26386426]
• Courivaud T, Ferrand N, Elkhattouti A et al. Functional Characterization of a WWP1/Tiul1 Tumor-derived Mutant Reveals a Paradigm of Its Constitutive Activation in Human Cancer. J Biol Chem. 2015-07-07 [PMID: 26152726]
• Ge F, Chen W, Qin J et al. Ataxin-3 like (ATXN3L), a member of the Josephin family of deubiquitinating enzymes, promotes breast cancer proliferation by deubiquitinating Kruppel-like factor 5 (KLF5). Oncotarget 2015-08-28 [PMID: 26079537]
• Chaudhary N, Maddika S. WWP2-WWP1 Ubiquitin Ligase Complex Coordinated by PPM1G Maintains the Balance Between Cellular p73 and deltaNp73 Levels. Mol Cell Biol. 2014-07-28 [PMID: 25071155]
• Cheng Q, Cao X, Yuan F et al. Knockdown of WWP1 inhibits growth and induces apoptosis in hepatoma carcinoma cells through the activation of caspase3 and p53. Biochem Biophys Res Commun. 2014-05-01 [PMID: 24792179]
• Yeung B, Ho KC, Yang X. WWP1 E3 Ligase Targets LATS1 for Ubiquitin-Mediated Degradation in Breast Cancer Cells PLoS One 2013-01-01 [PMID: 23573293] (WB, Human, Primate)
• Shu L, Zhang H, Boyce BF, Xing L. Ubiquitin E3 ligase Wwp1 negatively regulates osteoblast function by inhibiting osteoblast differentiation and migration. J Bone Miner Res. 2013-09-01 [PMID: 23553732] (WB)
• Cao X, Xue L, Han L et al. WWP1 delays cellular senescence by promoting p27Kip1 degradation in human diploid fibroblasts. J Biol Chem. 2011-07-27 [PMID: 21795702]
• Peschiaroli A, Scialpi F, Bernassola F et al. The E3 ubiquitin ligase WWP1 regulates DeltaNp63-dependent transcription through Lys63 linkages. Biochem Biophys Res Commun 402(2):425-30. 2010-11-12 [PMID: 20951678]
• Edwards TL, Clowes VE, Tsang HT et al. Endogenous spartin (SPG20) is recruited to endosomes and lipid droplets and interacts with the ubiquitin E3 ligases AIP4 and AIP5. Biochem J 423(1):31-9. 2009-09-14 [PMID: 19580544]
• Chen C, Zhou Z, Sheehan CE et al. Overexpression of WWP1 is associated with the estrogen receptor and insulin-like growth factor receptor 1 in breast carcinoma. Int J Cancer 2009-06-15 [PMID: 19267401] (WB, IHC-P, Human)

Bioinformatics

• Gene Symbol: WWP1
• OMIM:
  • 602307(Human)