XRCC2 Antibody [Janelia Fluor® 549]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Janelia Fluor 549

XRCC2 Antibody [Janelia Fluor® 549] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1).
  
  Sequence:
  MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XRCC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for XRCC2 Antibody [Janelia Fluor® 549]

• DKFZp781P0919
• DNA repair protein XRCC2
• X-ray repair complementing defective repair in Chinese hamster cells 2
• X-ray repair cross-complementing protein 2
• X-ray repair, complementing defective, repair in Chinese hamster

Background

RAD51 is a eukaryotic homologue of E. coli RecA, a recombinase, and a component of the homologous recombination DNA repair pathway. RAD51 forms a nucleoprotein filament (through binding RAD52 and single stranded DNA that are exposed following double strand breaks) that initiates recombination. There are five human homologues of RAD51; XRCC2, XRCC3, RAD51B, RAD51C, RAD51D, and they interact among themselves to form one big complex or several smaller complexes. XRCC2 (X Ray Repair Cross Complementing 2), a component of the homologous recombination pathway, is essential for repairing the double strand DNA breaks by homologous recombination between sister chromatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XRCC2