![Western Blot: AASS Antibody [NBP1-82832] - Analysis using Anti-AASS antibody NBP1-82832 (A) shows similar pattern to independent antibody NBP1-82833 (B).](http://images.novusbio.com/fullsize/AASS-Antibody-Western-Blot-NBP1-82832-img0013.jpg "Western Blot: AASS Antibody [NBP1-82832] - Analysis using Anti-AASS antibody NBP1-82832 (A) shows similar pattern to independent antibody NBP1-82833 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AASS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
| Publication using NBP1-82832 | Applications | Species |
|---|---|---|
| Houten SM, te Brinke H, Denis S et al. Genetic basis of hyperlysinemia. Orphanet J Rare Dis 2013-04-09 [PMID: 23570448] |
Secondary Antibodies |
Isotype Controls |
Research Areas for AASS Antibody (NBP1-82832)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AASS |
![Immunocytochemistry/Immunofluorescence: AASS Antibody [NBP1-82832] - Staining of human cell line U-251 MG shows localization to mitochondria.](http://images.novusbio.com/fullsize/AASS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82832-img0011.jpg "Immunocytochemistry/Immunofluorescence: AASS Antibody [NBP1-82832] - Staining of human cell line U-251 MG shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining in human liver and skeletal muscle tissues using NBP1-82832 antibody. Corresponding AASS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AASS-Antibody-Immunohistochemistry-Paraffin-NBP1-82832-img0022.jpg "Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining in human liver and skeletal muscle tissues using NBP1-82832 antibody. Corresponding AASS RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/AASS-Antibody-Immunohistochemistry-Paraffin-NBP1-82832-img0017.jpg "Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human endometrium, kidney, liver and skeletal muscle using Anti-AASS antibody NBP1-82832 (A) shows similar protein distribution across tissues to independent antibody NBP1-82831 (B).](http://images.novusbio.com/fullsize/AASS-Antibody-Immunohistochemistry-Paraffin-NBP1-82832-img0018.jpg "Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human endometrium, kidney, liver and skeletal muscle using Anti-AASS antibody NBP1-82832 (A) shows similar protein distribution across tissues to independent antibody NBP1-82831 (B).")
![Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/AASS-Antibody-Immunohistochemistry-Paraffin-NBP1-82832-img0019.jpg "Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/AASS-Antibody-Immunohistochemistry-Paraffin-NBP1-82832-img0020.jpg "Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/AASS-Antibody-Immunohistochemistry-Paraffin-NBP1-82832-img0021.jpg "Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![N/A IL-19 [HRP]](https://images.novusbio.com/images2/DATA_IL19_D1900_ELISA_541.jpg)
![N/A IL-19 [HRP]](https://images.novusbio.com/images2/IL-19_D1900_ELISA_16.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")