ABP1/AOC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ABP1/AOC1 Antibody [NBP1-89068] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: ABP1/AOC1 Antibody [NBP1-89068] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: ABP1/AOC1 Antibody [NBP1-89068] - Staining of human endometrium shows no membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: ABP1/AOC1 Antibody [NBP1-89068] - Staining of human placenta shows moderate membranous and cytoplasmic positivity in decidual cells.

Western Blot: ABP1/AOC1 Antibody [NBP1-89068] - Analysis in human cell line CAPAN-2.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABP1/AOC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AOC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ABP1/AOC1 Protein (NBP1-89068PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABP1/AOC1 Antibody - BSA Free

• ABP
• ABP1
• amiloride binding protein 1 (amine oxidase (copper-containing))
• Amiloride-binding protein
• amiloride-sensitive amine oxidase [copper-containing]
• amiloride-sensitive amine oxidase
• AOC1
• AOC1DAOamiloride-binding protein-1
• DAO1
• Diamine Oxidase
• EC 1.4.3
• EC 1.4.3.22
• Histaminase
• KAO
• Kidney amine oxidase

Background

ABP1 encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AOC1