ACAD9 Antibody - BSA Free

Western Blot: ACAD9 Antibody [NBP2-56718] - Analysis using Anti-ACAD9 antibody NBP2-56718 (A) shows similar pattern to independent antibody NBP1-82749 (B).

Immunocytochemistry/Immunofluorescence: ACAD9 Antibody [NBP2-56718] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACAD9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACAD9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACAD9 Recombinant Protein Antigen (NBP2-56718PEP)

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACAD9 Antibody - BSA Free

• ACAD-9
• acyl-CoA dehydrogenase family member 9, mitochondrial
• acyl-CoA dehydrogenase family, member 9
• acyl-Coenzyme A dehydrogenase family, member 9
• EC 1.3.99
• EC 1.3.99.-
• EC 1.3.99.10
• FLJ23533
• MGC14452
• NPD002

Background

Mitochondrial fatty acid beta-oxidation is one of the main energy-producing metabolic pathways in eukaryotes. Acyl-CoA dehydrogenases (ACADs; EC 1.3.99.13) are mitochondrial enzymes that catalyze the initial rate-limiting step in the beta-oxidation of fatty acyl-CoA. ACAD9 belongs to a group of ACADs that act on fatty acids containing 14 to 20 carbons (Zhang et al., 2002 [PubMed 12359260]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACAD9