ACF1 Antibody [Alexa Fluor® 594]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Alexa Fluor 594

ACF1 Antibody [Alexa Fluor® 594] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1347-1556 of human ACF1 (NP_038476.2).
  
  Sequence:
  VFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSVNIASKLSLQESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAZ1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for ACF1 Antibody [Alexa Fluor® 594]

• ACF1hWALp1
• ATP-dependent chromatin remodeling protein
• ATP-dependent chromatin-remodeling protein
• ATP-utilizing chromatin assembly and remodeling factor 1
• bromodomain adjacent to zinc finger domain protein 1A
• bromodomain adjacent to zinc finger domain, 1A
• CHRAC subunit ACF1
• hACF1FLJ14383
• WALp1
• WCRF180DKFZp586E0518
• Williams syndrome transcription factor-related chromatin-remodeling factor 180

Background

ACF1/BAZ1A is a subunit of the ACF chromatin-remodeling complex and the ISWI CHRAC remodeling complex. In the ACF complex, ACF1/BAZ1A functions to influence the nucleosome remodeling activity of the SNF2h ATPase. As part of the CHRAC complex, ACF1/BAZ1A may function to target CHRAC to heterochromatin. ACF1 has also been shown to interact with the nuclear receptor corepressor protein (N-CoR) to facilitate the repression of transcription by unliganded nuclear receptors. Alternate names for ACF1/BAZ1A include ATP-utilizing chromatin assembly and remodeling factor1, hACF1, bromodomain adjacent to zinc finger domain protein 1A, Williams syndrome transcription factor-related chromatin-remodeling factor 180, WCRF180, hWALp1, and CHRAC subunit ACF1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAZ1A