ACSL1 Antibody - BSA Free

Western Blot: ACSL1 Antibody [NBP1-60016] - Human Hela

Immunohistochemistry: ACSL1 Antibody [NBP1-60016] - Human kidney, renal corpuscle cells are marked by arrows. Reccomended concentration is 4 - 8 ug/ml.

Western Blot: ACSL1 Antibody [NBP1-60016] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Western Blot: ACSL1 Antibody [NBP1-60016] - Hum. Fetal Brain.

Western Blot: ACSL1 Antibody [NBP1-60016] - Human Hela.

Western Blot: ACSL1 Antibody [NBP1-60016] - Human 721_B cells ACSL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-60016] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Immunohistochemistry: ACSL1 Antibody [NBP1-60016] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Immunohistochemistry: ACSL1 Antibody [NBP1-60016] - heart, liver, pancreas, brain

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ACSL1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ACSL1 (acyl-CoA synthetase long-chain family member 1) The peptide sequence was selected from the C terminal of ACSL1. Peptide sequence GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACSL1 Antibody - BSA Free

• ACS1LACS 2
• Acyl-CoA synthetase 1
• acyl-CoA synthetase long-chain family member 1
• EC 6.2.1
• FACL1EC 6.2.1.3
• fatty-acid-Coenzyme A ligase, long-chain 1
• LACS 1
• LACSlong-chain 2
• lignoceroyl-CoA synthase
• Long-chain acyl-CoA synthetase 1
• Long-chain acyl-CoA synthetase 2
• Long-chain fatty acid-CoA ligase 2
• long-chain fatty-acid-coenzyme A ligase 1
• long-chain-fatty-acid--CoA ligase 1
• Palmitoyl-CoA ligase 1
• Palmitoyl-CoA ligase 2
• paltimoyl-CoA ligase 1

Background

ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACSL1
• Uniprot:
  • P33121(Human)