ACSL1 Antibody - BSA Free

Western Blot: ACSL1 Antibody [NBP1-89270] - Analysis using Anti-ACSL1 antibody NBP1-89270 (A) shows similar pattern to independent antibody NBP1-89271 (B).

Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP1-89270] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney, liver, soft tissues and tonsil using Anti-ACSL1 antibody NBP1-89270 (A) shows similar protein distribution across tissues to independent antibody NBP1-89271 (B).

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Analysis in human liver and tonsil tissues. Corresponding ACSL1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human soft tissues shows moderate to strong cytoplasmic positivity in adipocytes.

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human tonsil shows no cytoplasmic positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACSL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ACSL1 Protein (NBP1-89270PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACSL1 Antibody - BSA Free

• ACS1LACS 2
• Acyl-CoA synthetase 1
• acyl-CoA synthetase long-chain family member 1
• EC 6.2.1
• FACL1EC 6.2.1.3
• fatty-acid-Coenzyme A ligase, long-chain 1
• LACS 1
• LACSlong-chain 2
• lignoceroyl-CoA synthase
• Long-chain acyl-CoA synthetase 1
• Long-chain acyl-CoA synthetase 2
• Long-chain fatty acid-CoA ligase 2
• long-chain fatty-acid-coenzyme A ligase 1
• long-chain-fatty-acid--CoA ligase 1
• Palmitoyl-CoA ligase 1
• Palmitoyl-CoA ligase 2
• paltimoyl-CoA ligase 1

Background

Long-chain-fatty-acid--CoA ligase 1, or ACSL1, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in lipid biosynthesis and fatty acid degradation. Like other isozymes of this family, ALCS1 converts free long-chain fatty acids into fatty acyl-CoA esters. ACSL1 preferentially uses palmitoleate, oleate and linoleate, and altered expression of ACSL1 is thought to increase accumulation of triglycerides in the liver.

ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for ACSL1 Antibody (NBP1-89270) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer IHC-Fr Rat 12/22/2017

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: brain tissue (hippocampus)
• Species: Rat
• Lot: A40997

Comments

• Comments: Name: S100A10 antibody
  Catalog #: NBP1-89370
  Lot Number: A40997
  Antibody Storage Conditions:-20℃
  Application Tested: IHC-Fr
  Staining Expectations: co-labell A2 astrocytes with gfap
  Observation & Concerns: The background is very deep and the A2 astrocyte can’t be stained.
  Test Sample Information:
  Species & Treatments: SD rats & infrasound models
  Tissue: brain tissue (hippocampus)
  Fixative Composition: 4% paraformaldehyde solution
  Fixation Time & Temperature: 6 h or longer
  Tissue Processing: antigen retrieval, EDTA pH9.0, 95C, 15min
  
  
  Blocking Procedure:
  Blocking Solution: 3%BSA/5%BSA
  Time & Temperature: 0.5 or 1 h & room temperature
  Blocking Time: Click here to enter text.
  Primary Antibody
  Dilution: 1:25; 1:50; 1:100; 1:200; 1:500
  Diluent Buffer: 3%BSA，0.3%Triton
  Time & Temperature: 12 h & 4℃
  Washing Conditions:
  Wash Buffer Composition: 1 * PBS
  Method (Immersion, Rinsing etc.): Immersion
  Times/Washing: 3 * 10 min
  Repetitions: 3 times
  Secondary Antibody
  Manufacturer and Catalog #: CWBIO & CW0114S
  Secondary description: anti-rabbit secondary antibody is available, see section controls and additional images.
  Dilution: 1:200
  Diluent Buffer: 1 * PBS(hoechest, PH=7.4)
  Incubation Time & Temperature: 2 h & room temperature
  Post-Secondary Washing: the same as post-primary washing
  Detection Method:
  Detection: DM4000
  
  
  Controls:
  Positive Control: the anti-rabbit secondary antibody is available
  Negative Control: the production can not co-labell A2 ast

Bioinformatics

• Gene Symbol: ACSL1
• Entrez:
  • 2180(Human)
• Uniprot:
  • P33121(Human)