Recombinant Human Adenine Nucleotide Translocase 1 GST (N-Term) Protein

SDS-Page: Adenine Nucleotide Translocase 1 Recombinant Protein [H00000291-P01]

Product Discontinued

Recombinant Human Adenine Nucleotide Translocase 1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-298 of Human SLC25A4
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SLC25A4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 59.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenine Nucleotide Translocase 1 GST (N-Term) Protein

• AAC1
• Adenine nucleotide translocator 1
• ADP
• ADP/ATP translocase 1
• ANT 1
• ANT1adenine nucleotide translocator 1 (skeletal muscle)
• ATP carrier protein 1
• ATP carrier protein, heart/skeletal muscle isoform T1
• ATP carrier protein, heart/skeletal muscle
• heart/skeletal muscle ATP/ADP translocator
• PEO2
• PEO3
• solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4
• Solute carrier family 25 member 4
• T1ANT

Background

Adenine Nucleotide Translocase 1 (ANT1) catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It is is a key component of the mitochondrial permeability transition pore (PT pore) complex and is also one of the most abundant proteins in the mitochondrion making up approximately 10% of all mitochondrial proteins. Originally described as an ADP/ATP exchange factor, ANT1 has also been shown to be required for bax mediated apoptosis. This is effected by binding of bax to residues 105-156 of ANT1, presumably resulting in maintaining the PT pore in an open conformation. Interaction with bax is not required for ANT1 pro-apoptotic activity as overexpression of the ANT1 protein also leads to the induction of apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A4