Alanyl tRNA synthetase Antibody - BSA Free

Western Blot: Alanyl tRNA synthetase Antibody [NBP2-58166] - Analysis using Anti-AARS antibody NBP2-58166 (A) shows similar pattern to independent antibody NBP1-87414 (B).

Immunocytochemistry/Immunofluorescence: Alanyl tRNA synthetase Antibody [NBP2-58166] - Staining of human cell line U-251 MG shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Alanyl tRNA synthetase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCP
• Predicted Species: Mouse (95%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AARS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Alanyl tRNA synthetase Recombinant Protein Antigen (NBP2-58166PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Alanyl tRNA synthetase Antibody - BSA Free

• alanine tRNA ligase 1, cytoplasmic
• Alanine--tRNA ligase
• alanyl-tRNA synthetase
• alanyl-tRNA synthetase, cytoplasmic
• alaRS
• CMT2N
• EC 6.1.1
• EC 6.1.1.7
• Renal carcinoma antigen NY-REN-42

Background

The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AARS1