Alix Antibody - BSA Free

Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Alix Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND
• Marker: Exosome Marker
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDCD6IP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Alix Protein (NBP1-90201PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Alix Antibody - BSA Free

• AIP1DRIP4
• ALG-2 interacting protein 1
• ALG-2 interacting protein X
• ALG-2-interacting protein 1
• alinx
• Alix
• apoptosis-linked gene 2-interacting protein X
• dopamine receptor interacting protein 4
• HP95
• KIAA1375
• MGC17003
• PDCD6-interacting protein
• programmed cell death 6 interacting protein
• programmed cell death 6-interacting protein

Background

Alix encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Alix Antibody (NBP1-90201)(11)

Publications using NBP1-90201

• Krause, GJ;Kirchner, P;Stiller, B;Morozova, K;Diaz, A;Chen, KH;Krogan, NJ;Agullo-Pascual, E;Clement, CC;Lindenau, K;Swaney, DL;Dilipkumar, S;Bravo-Cordero, JJ;Santambrogio, L;Cuervo, AM; Molecular determinants of the crosstalk between endosomal microautophagy and chaperone-mediated autophagy Cell reports 2023-12-05 [PMID: 38060380]
• Blommer J, Pitcher T, Mustapic M et al. Extracellular vesicle biomarkers for cognitive impairment in Parkinson's disease Brain : a journal of neurology 2022-07-14 [PMID: 35833836]
• Busch DJ, Zhang y, Kumar A et al. Identification of RNA content of CHO-derived extracellular vesicles from a production process Journal of biotechnology 2022-03-12 [PMID: 35292346] (WB)
• Aiello A, Giannessi F, Percario ZA et al. HIV-1 Nef Protein Affects Cytokine and Extracellular Vesicles Production in the GEN2.2 Plasmacytoid Dendritic Cell Line Viruses 2021-12-31 [PMID: 35062278] (WB, Human)
• Yao PJ, Eren E, Goetzl EJ, Kapogiannis D Mitochondrial Electron Transport Chain Protein Abnormalities Detected in Plasma Extracellular Vesicles in Alzheimer's Disease Biomedicines 2021-10-31 [PMID: 34829816] (WB, Human)
• Carlomagno C, Giannasi C, Niada S et al. Raman Fingerprint of Extracellular Vesicles and Conditioned Media for the Reproducibility Assessment of Cell-Free Therapeutics Frontiers in Bioengineering and Biotechnology 2021-04-13 [PMID: 33928071] (WB, Human)
• Millan C, Prause L, Vallmajo-Martin Q et al. Extracellular Vesicles from 3D Engineered Microtissues Harbor Disease-Related Cargo Absent in EVs from 2D Cultures Advanced healthcare materials 2021-04-22 [PMID: 33890421]
• Morris C, Durand S, Jalinot P Decreased expression of the translation factor eIF3e induces senescence in breast cancer cells via suppression of PARP1 and activation of mTORC1 Oncotarget 2021-03-30 [PMID: 33868586] (WB, Human)
• Mansur RB, Delgado-Peraza F, Subramaniapillai M et al. Exploring brain insulin resistance in adults with bipolar depression using extracellular vesicles of neuronal origin Journal of psychiatric research 2020-12-04 [PMID: 33316649] (WB, Human)
• Nogueras-Ortiz, C J, Mahairaki, V Et al. Astrocyte- and Neuron-Derived Extracellular Vesicles from Alzheimer's Disease Patients Effect Complement-Mediated Neurotoxicity. Cells 2020-07-04 [PMID: 32635578] (WB, Human)
• Beckwith KS, Beckwith MS, Ullmann S et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection Nat Commun 2020-05-10 [PMID: 32385301]

Review for Alix Antibody (NBP1-90201) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer WB Rat 01/17/2018

Summary

• Application: Western Blot
• Sample Tested: Rat astrocytes
• Species: Rat
• Lot: A114984

Bioinformatics

• Gene Symbol: PDCD6IP