AMPK beta 2/PRKAB2 Antibody - BSA Free

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581] - Mouse Liver Dilution: 1 to 1000

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581] - Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AMPK beta 2/PRKAB2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PRKAB2(protein kinase, AMP-activated, beta 2 non-catalytic subunit) The peptide sequence was selected from the middle region of PRKAB2 (NP_005390). Peptide sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKAB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AMPK beta 2/PRKAB2 Antibody - BSA Free

• 5'-AMP-activated protein kinase, beta-2 subunit
• AMPK beta 2
• AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2
• AMPK beta-2 chain
• AMPK subunit beta-2
• MGC61468
• PRKAB2
• protein kinase, AMP-activated, beta 2 non-catalytic subunit

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKAB2
• Entrez:
  • 5565(Human)
  • 108097(Mouse)
  • 64562(Rat)
• Uniprot:
  • O43741()