AP-2 beta/TFAP2B Antibody - BSA Free

Immunohistochemistry-Paraffin: AP-2 beta/TFAP2B Antibody [NBP1-89063] - Staining of human epididymis shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AP-2 beta/TFAP2B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFAP2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 28894266)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AP-2 beta/TFAP2B Protein (NBP1-89063PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28894266).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AP-2 beta/TFAP2B Antibody - BSA Free

• activating enhancer binding protein 2 beta
• Activating enhancer-binding protein 2-beta
• AP2 beta
• AP-2 beta
• AP-2B
• AP2-B
• AP2-beta
• CHAR
• MGC21381
• TFAP2B
• transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
• transcription factor AP-2 beta (activating enhancer-binding protein 2 beta)
• transcription factor AP-2-beta

Background

The TFAP2B gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AP-2 beta/TFAP2B Antibody (NBP1-89063)(1)

Publication using NBP1-89063

• Barzago MM, Kurosaki M, Fratelli M et al. Generation of a new mouse model of glaucoma characterized by reduced expression of the AP-2B and AP-2d proteins Sci Rep 2017-09-11 [PMID: 28894266] (WB, Mouse)

Bioinformatics

• Gene Symbol: TFAP2B