Aquaporin-9 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aquaporin-9 Antibody [NBP2-92558] - Human liver cancer using Aquaporin-9 Rabbit pAb (NBP2-92558) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Aquaporin-9 Antibody - BSA Free [NBP2-92558] - Immunofluorescence analysis of human liver using Aquaporin-9 Rabbit pAb at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aquaporin-9 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human Aquaporin-9 (NP_066190.2). SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AQP9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aquaporin-9 Antibody - BSA Free

• AQP-9
• Aquaglyceroporin-9
• aquaporin 9
• aquaporin-9
• HsT17287
• Small solute channel 1
• SSC1aquaglyceroporin-9

Background

The aquaporins are a family of water-selective membrane channels. The protein encoded by this gene allows passage of awide variety of noncharged solutes. It stimulates urea transport and osmotic water permeability; there arecontradicting reports about its role in providing glycerol permeability. The encoded protein may also play a role inspecialized leukocyte functions such as immunological response and bactericidal activity. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AQP9