ARHGAP12 Antibody - BSA Free

Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining in human stomach and skeletal muscle tissues using NBP1-91678 antibody. Corresponding ARHGAP12 RNA-seq data are presented for the same tissues.

Western Blot: ARHGAP12 Antibody [NBP1-91678] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: ARHGAP12 Antibody [NBP1-91678] - Analysis in human cell line CAPAN-2.

Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human colorectal cancer shows strong cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
• Theoretical MW: 96 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ARHGAP12 Protein (NBP1-91678PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26465210).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGAP12 Antibody - BSA Free

• Rho GTPase activating protein 12

Background

RHO GTPases (see ARHA, MIM 165390) that participate in a wide variety of cellular processes are active in their GTP-bound form and inactive in their GDP-bound form. The hydrolysis of GTP and the inactivation of these GTPases are regulated by GTPase-activating proteins (GAPs), such as ARHGAP12 (Zhang et al., 2002 [PubMed 11854031]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP12 Antibody (NBP1-91678)(1)

Publication using NBP1-91678

• Schlam D, Bagshaw RD, Freeman SA et al. Phosphoinositide 3-kinase enables phagocytosis of large particles by terminating actin assembly through Rac/Cdc42 GTPase-activating proteins. Nat Commun 2015-10-14 [PMID: 26465210] (WB, Human)

Bioinformatics

• Gene Symbol: ARHGAP12
• Entrez:
  • 94134(Human)
• Uniprot:
  • Q8IWW6(Human)