![Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Analysis in human colon and liver tissues using NBP2-49187 antibody. Corresponding B7-H7/HHLA2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/B7-H7-HHLA2-Antibody-Immunohistochemistry-Paraffin-NBP2-49187-img0016.jpg "Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Analysis in human colon and liver tissues using NBP2-49187 antibody. Corresponding B7-H7/HHLA2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HHLA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Flow_Cytometry_16025.jpg)
![Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Immunohistochemistry_17363.jpg)
![Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Dual_RNAscope_ISHIHC_23827.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for B7-H7/HHLA2 Antibody (NBP2-49187)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HHLA2 |
![Western Blot: B7-H7/HHLA2 Antibody [NBP2-49187] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize/B7-H7-HHLA2-Antibody-Western-Blot-NBP2-49187-img0015.jpg "Western Blot: B7-H7/HHLA2 Antibody [NBP2-49187] - Analysis in human cell line HDLM-2.")
![Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/B7-H7-HHLA2-Antibody-Immunohistochemistry-Paraffin-NBP2-49187-img0011.jpg "Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/B7-H7-HHLA2-Antibody-Immunohistochemistry-Paraffin-NBP2-49187-img0012.jpg "Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/B7-H7-HHLA2-Antibody-Immunohistochemistry-Paraffin-NBP2-49187-img0013.jpg "Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/B7-H7-HHLA2-Antibody-Immunohistochemistry-Paraffin-NBP2-49187-img0014.jpg "Immunohistochemistry-Paraffin: B7-H7/HHLA2 Antibody [NBP2-49187] - Staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells.")
![NKp30/NCR3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NKp30/NCR3 [Unconjugated]")
![ELISA B7-H6 Antibody (875001) [Unconjugated]](https://images.novusbio.com/images2/B7H6_MAB7144_ELISA_22050.jpg)
![Knockout Validated B7-H6 Antibody (875001) [Unconjugated]](https://images.novusbio.com/images2/B7H6_MAB7144_Knockout_Validated_22940.jpg)
![Flow Cytometry B7-H6 Antibody (875001) [Unconjugated]](https://images.novusbio.com/images/antibody/mab7144_human-b7-h6-mab-clone-875001-flow-cytometry-30112023163225..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")