BDH1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BDH1 Antibody [NBP1-88673] - Analysis in human liver and skeletal muscle tissues using antibody. Corresponding BDH1 RNA-seq data are presented for the same tissues.

Western Blot: BDH1 Antibody [NBP1-88673] - Analysis in human liver tissue.

Immunocytochemistry/Immunofluorescence: BDH1 Antibody [NBP1-88673] - Staining of human cell line U-251 MG shows localization to nucleoplasm and mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BDH1 Antibody [NBP1-88673] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: BDH1 Antibody [NBP1-88673] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: BDH1 Antibody [NBP1-88673] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: BDH1 Antibody [NBP1-88673] - Staining of human rectum shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: BDH1 Antibody [NBP1-88673] - Staining of human kidney shows moderate cytoplasmic granular positivity in cells in tubules.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BDH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BDH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID:35902007).
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BDH1 Protein (NBP1-88673PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BDH1 Antibody - BSA Free

• (R)-3-hydroxybutyrate dehydrogenase
• 3-hydroxybutyrate dehydrogenase
• 3-hydroxybutyrate dehydrogenase, type 1
• EC 1.1.1
• MGC2723
• MGC4347
• MGC9788
• mitochondrial
• mitochondrial)
• short chain dehydrogenase/reductase family 9C, member 1

Background

BDH1 encodes a member of the short-chain dehydrogenase/reductase gene family. The encoded protein forms a homotetrameric lipid-requiring enzyme of the mitochondrial membrane and has a specific requirement for phosphatidylcholine for optimal enzymatic activity. The encoded protein catalyzes the interconversion of acetoacetate and (R)-3-hydroxybutyrate, the two major ketone bodies produced during fatty acid catabolism. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BDH1 Antibody (NBP1-88673)(5)

Publications using NBP1-88673

• Persad KL Contribution of Energy Metabolism to Cardiomyocyte Maturation Thesis 2023-01-01 (WB, Rat)
• Torres JA, Holznecht N, Asplund DA, Kroes BC et Al. ?-hydroxybutyrate recapitulates the beneficial effects of ketogenic metabolic therapy in polycystic kidney disease iScience 2024-09-24 [PMID: 39314240]
• Soni S, Martens MD, Takahara S et al. Exogenous ketone ester administration attenuates systemic inflammation and reduces organ damage in a lipopolysaccharide model of sepsis Biochimica et biophysica acta. Molecular basis of disease 2022-07-25 [PMID: 35902007] (IHC-Fr, Mouse)
• Gouirand V, Gicquel T, Lien EC et al. Ketogenic HMG-CoA lyase and its product beta-hydroxybutyrate promote pancreatic cancer progression The EMBO journal 2022-03-21 [PMID: 35307861] (IF/IHC, WB, Mouse)
• Greenwell AA, Gopal K, Altamimi TR et al. Barth syndrome-related cardiomyopathy is associated with a reduction in myocardial glucose oxidation American journal of physiology. Heart and circulatory physiology 2021-06-01 [PMID: 33929899]

Bioinformatics

• Gene Symbol: BDH1