Reactivity | Hu, Mu, Pm, RMSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | BDNF |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31849603). |
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Publications using NBP1-59304 | Applications | Species |
---|---|---|
Ediga PK, Phadtare CV A Study on Regulation of HDAC1 2 Activity by Ube3a Implication in Angelman Syndrome Conference 2023-01-01 | ||
Du T T, Zhu G et al. Anterior thalamic nucleus stimulation protects hippocampal neurons by activating autophagy in epileptic monkeys. Aging (Albany NY) 2020-08-04 [PMID: 32267832] (WB, Rhesus Macaque) | WB | Rhesus Macaque |
Kumar V, Joshi T, Vatsa N, et al. Simvastatin Restores HDAC1/2 Activity and Improves Behavioral Deficits in Angelman Syndrome Model Mouse Front Mol Neurosci 2019-11-26 [PMID: 31849603] (ICC/IF, Mouse) | ICC/IF | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for BDNF Antibody (NBP1-59304)Find related products by research area.
|
Read full blog post. |
The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura. It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol... Read full blog post. |
The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2 Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain. Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa). The importance of t... Read full blog post. |
Niemann Pick-C1 and cholesterol dynamics Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis. Although cholesterol moves freely inside the cell, it cannot independently expo... Read full blog post. |
Synapsin I: Implicated in synaptic activity across a diverse range of studies Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal. Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i... Read full blog post. |
TrkB: Bridging Ontogenesis and Oncogenesis Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ... Read full blog post. |
TrkB and Nervous System Function Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur... Read full blog post. |
TrkB: Docking for Neurotrophins and Beyond. Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro... Read full blog post. |
BDNF Antibodies Aid Research on Alzheimer's Therapies Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer... Read full blog post. |
BDNF Antibodies and Synaptic Research Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.