Beta 2 Adaptin Antibody - BSA Free

Western Blot: Beta 2 Adaptin Antibody [NBP1-56481] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Beta 2 Adaptin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AP2B1(adaptor-related protein complex 2, beta 1 subunit) The peptide sequence was selected from the middle region of AP2B1. Peptide sequence SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: beta.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP2B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Beta 2 Adaptin Antibody - BSA Free

• Adapter-related protein complex 2 beta subunit
• Adaptor protein complex AP-2 subunit beta
• adaptor-related protein complex 2, beta 1 subunit
• ADTB2adaptin, beta 2 (beta)
• AP105B
• AP2-BETA
• beta-2-adaptin
• beta-adaptin
• CLAPB1AP-2 complex subunit beta
• Clathrin assembly protein complex 2 beta large chain
• clathrin-associated/assembly/adaptor protein, large, beta 1
• DKFZp781K0743
• Plasma membrane adaptor HA2/AP2 adaptin beta subunit

Background

AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP2B1
• Uniprot:
  • P63010(Human)