BRN3A Antibody (7B4) - Azide and BSA Free

Western Blot: BRN3A Antibody (7B4) [H00005457-M04] - Analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysatE (46.09 KDa). Lane 2: Non-transfected lysate.

ELISA: BRN3A Antibody (7B4) [H00005457-M04] - Detection limit for recombinant GST tagged POU4F1 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 7B4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BRN3A Antibody (7B4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: POU4F1 (NP_006228.2, 331 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: POU4F1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRN3A Antibody (7B4) - Azide and BSA Free

• Brain-3A
• Brain-specific homeobox/POU domain protein 3A
• brn-3A
• BRN3Abrain-3A
• FLJ13449
• Homeobox/POU domain protein RDC-1
• Oct-T1
• POU class 4 homeobox 1
• POU domain class 4, transcription factor 1
• POU domain, class 4, transcription factor 1
• RDC1
• RDC-1

Background

Brn-3a is a transcription factor belonging to the class IV of POU domain transcription factors. It is expressed throughout the peripheral nervous system but especially in postmitotic sensory neurons of dorsal root ganglia. Brn-3a is known to regulate different genes involved in neuronal differentiation and survival (1). Characterization of Brn-3a suggests potential roles of Brn-3a in the development of retinal ganglion cells and sensory neurons, as well as potential roles in the pituitary gland and the immune system. Brn-3a is expressed in the pituitary gland and in a corticotroph cell line (2). The differentiation of the ND7 neuronal cell line to a nondividing phenotype bearing numerous neurite processes is accompanied by a dramatic increase in the levels of the activating POU family transcription factor Brn-3a and a corresponding fall in the levels of the closely related inhibitory factor Brn-3b. Over expression of Brn-3a in these cells can induce neurite outgrowth and the activation of genes encoding synaptic vesicle proteins in the absence of a differentiation-inducing stimulus (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU4F1
• Uniprot:
  • NP_006228(Human)