BRN3A Antibody - BSA Free

Western Blot: BRN3A Antibody [NBP2-83954] - Host: Rabbit. Target Name: POU4F1. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BRN3A Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human BRN3A. Peptide sequence: PTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU4F1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BRN3A Antibody - BSA Free

• Brain-3A
• Brain-specific homeobox/POU domain protein 3A
• brn-3A
• BRN3Abrain-3A
• FLJ13449
• Homeobox/POU domain protein RDC-1
• Oct-T1
• POU class 4 homeobox 1
• POU domain class 4, transcription factor 1
• POU domain, class 4, transcription factor 1
• RDC1
• RDC-1

Background

Brn-3a is a transcription factor belonging to the class IV of POU domain transcription factors. It is expressed throughout the peripheral nervous system but especially in postmitotic sensory neurons of dorsal root ganglia. Brn-3a is known to regulate different genes involved in neuronal differentiation and survival (1). Characterization of Brn-3a suggests potential roles of Brn-3a in the development of retinal ganglion cells and sensory neurons, as well as potential roles in the pituitary gland and the immune system. Brn-3a is expressed in the pituitary gland and in a corticotroph cell line (2). The differentiation of the ND7 neuronal cell line to a nondividing phenotype bearing numerous neurite processes is accompanied by a dramatic increase in the levels of the activating POU family transcription factor Brn-3a and a corresponding fall in the levels of the closely related inhibitory factor Brn-3b. Over expression of Brn-3a in these cells can induce neurite outgrowth and the activation of genes encoding synaptic vesicle proteins in the absence of a differentiation-inducing stimulus (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU4F1