c-Abl Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

c-Abl Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABL1.
  
  

  Source: E. coli

  Amino Acid Sequence: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ABL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90287.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for c-Abl Recombinant Protein Antigen

• Abelson murine leukemia viral oncogene homolog 1
• ABL
• ABL1
• bcr/abl
• BCR-ABL1
• c-abl oncogene 1, non-receptor tyrosine kinase
• c-abl oncogene 1, receptor tyrosine kinase
• cAbl
• c-Abl
• EC 2.7.10
• EC 2.7.10.2
• JTK7
• JTK7bcr/abl
• p150bcr/c-abl oncogene protein
• Proto-oncogene c-Abl
• proto-oncogene tyrosine-protein kinase ABL1
• tyrosine-protein kinase ABL1
• v-abl Abelson murine leukemia viral oncogene homolog 1
• v-abl

Background

c-Abl is the human cellular homolog of a the v-Abl viral oncogene. v-Abl was originally discovered as a mouse cell-derived sequence in the genome of the Abelson murine leukemia virus (A-MuLV), a transforming retrovirus isolated by the laboratory of Dr. H.T. Abelson. c-Abl is a tyrosine kinase from the Src-family of tyrosine kinases that localizes to both the cytoplasm and nucleus. It bears an SH2 (src-homology 2) and SH3 (src-homology 3) domain responsible for mediating c-Abl protein-protein interactions. c-Abl is implicated to play a role in multiple cellular processes such as cell cycle checkpoint signaling, apoptosis, cell differentiation, cell adhesion, and transcriptional regulation. Chromosomal translocations involving the c-Abl gene are associated with human leukemias.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ABL1