CAPSL Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CAPSL Antibody [NBP2-32387] - Staining of human cell line U-2 OS shows localization to nucleus and microtubules.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human liver.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows distinct positivity in cytoplasm and cilia in subsets of glandular cells.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining in human fallopian tube and prostate tissues using anti-CAPSL antibody. Corresponding CAPSL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human fallopian tube, kidney, liver and lymph node using Anti-CAPSL antibody NBP2-32387 (A) shows similar protein distribution across tissues to independent antibody NBP2-14437 (B).

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human lymph node.

Immunohistochemistry-Paraffin: CAPSL Antibody [NBP2-32387] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAPSL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQ
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPSL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CAPSL Protein (NBP2-32387PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CAPSL Antibody - BSA Free

• calcyphosine-like
• calcyphosin-like protein
• MGC26610

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPSL