CBS Antibody

Western Blot: CBS Antibody [H00000875-A01] - Analysis of CBS expression in K-562 (Cat # L009V1).

Western Blot: CBS Antibody [H00000875-A01] - Effect of CBS knockdown on orthotopic chemoresistant ovarian cancer growth. Immunoblotting of tumor samples for confirmation of CBS knockdown on orthotopic chemoresistant ovarian cancer growth. One animal from each group was selected for immunoblotting analysis. Lane 1 and lane 4 are from different blots. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0079167), licensed under a CC-BY license.

Product Discontinued

CBS Antibody Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CBS (AAH11381.1, 1 a.a. - 551 a.a.) full-length recombinant protein with GST tag. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
• Specificity: CBS - cystathionine-beta-synthase
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CBS
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. IP usage reported in scientific literature (PMID: 23592311).

Reactivity Notes

Mouse reported in scientific literature (PMID: 22517358).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50 % glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBS Antibody

• cystathionine-beta-synthase
• EC 4.2.1.2210Beta-thionase

Background

The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CBS Antibody (H00000875-A01)(20)

Publications using H00000875-A01

• Partearroyo T, Murillo-Cuesta S, Vallecillo N et al. Betaine-homocysteine S-methyltransferase deficiency causes increased susceptibility to noise-induced hearing loss associated to plasma hyperhomocysteinemia. FASEB J. 2019-02-12 [PMID: 30753104]
• Ismail HM, Krishnamoorthy N, Al-Dewik N et al. In silico and in vivo models for Qatari-Specific classical homocystinuria as basis for development of novel therapies. Hum Mutat. 2018-11-23 [PMID: 30408270]
• Poloni S, Sperb-Ludwig F, Borsatto T et al. CBS mutations are good predictors for B6-responsiveness: A study based on the analysis of 35 Brazilian Classical Homocystinuria patients. Mol Genet Genomic Med 2018-01-20 [PMID: 29352562]
• Gambari L, Lisignoli G, Gabusi E et al. Distinctive Expression Pattern of Cystathionine-B-Synthase and Cystathionine-gamma -Lyase Identifies Mesenchymal Stromal Cells Transition to Mineralizing Osteoblasts. J Cell Physiol 2017-01-25 [PMID: 28121025]
• Grassi F, Malik Tyagi A, Calvert JW et al. Hydrogen Sulfide Is a Novel Regulator of Bone Formation Implicated in the Bone Loss Induced by Estrogen Deficiency. J Bone Miner Res 2015-11-28 [PMID: 26614970]
• Saha S, Chakraborty PK, Xiong X et al. Cystathionine b-synthase regulates endothelial function via protein S-sulfhydration. FASEB J. 2015-09-24 [PMID: 26405298]
• Martinez-Vega R, Partearroyo T, Vallecillo N et al. Long-term omega-3 fatty acid supplementation prevents expression changes in cochlear homocysteine metabolism and ameliorates progressive hearing loss in C57BL/6J mice. J Nutr Biochem 2015-12-01 [PMID: 26321228] (Mouse)
• Martinez-Vega R, Garrido F, Partearroyo T et al. Folic acid deficiency induces premature hearing loss through mechanisms involving cochlear oxidative stress and impairment of homocysteine metabolism. FASEB J. 2014-11-10 [PMID: 25384423]
• Kim Soohee, Lee Seung Heon, Lee Seungwoo et al. Arsenite-induced changes in hepatic protein abundance in cynomolgus monkeys (Macaca fascicularis). Proteomics. 2014-07-03 [PMID: 24866292]
• Bhattacharyya S, Saha S, Giri K et al. Cystathionine Beta-Synthase (CBS) Contributes to Advanced Ovarian Cancer Progression and Drug Resistance. PLoS One. 2013-11-13 [PMID: 24236104]
• Gupta S, Wang L, Anderl J et al. Correction of cystathionine beta-synthase deficiency in mice by treatment with proteasome inhibitors. Hum Mutat. 2013-08-01 [PMID: 23592311] (IP)
• Conrad C, Gregorio J, Wang YH et al. Plasmacytoid dendritic cells promote immunosuppression in ovarian cancer via ICOS costimulation of Foxp3(+) T-regulatory cells. Cancer Res. 2012-10-15 [PMID: 22850422] (Human)
• Sen U, Sathnur PB, Kundu S et al. Increased endogenous H2S generation by CBS, CSE, and 3MST gene therapy improves ex vivo renovascular relaxation in hyperhomocysteinemia Am J Physiol Cell Physiol 2012-07-01 [PMID: 22517358] (WB, Mouse)
• Mayfield JA, Davies MW, Dimster-Denk D et al. Surrogate genetics and metabolic profiling for characterization of human disease alleles. Genetics. 2012-04-01 [PMID: 22267502] (WB)
• Wu N, Siow YL, O K. Ischemia/reperfusion reduces transcription factor Sp1-mediated cystathionine beta-synthase expression in the kidney. J Biol Chem. 2010-04-14 [PMID: 20392694]
• Singh LR, Gupta S, Honig NH et al. Activation of mutant enzyme function in vivo by proteasome inhibitors and treatments that induce Hsp70. PLoS Genet;6(1):e1000807. 2010-01-01 [PMID: 20066033]
• d'Emmanuele di Villa Bianca R, Sorrentino R, Maffia P et al. Hydrogen sulfide as a mediator of human corpus cavernosum smooth-muscle relaxation. PNAS;106(11):4513-4518. 2009-01-01 [PMID: 19255435]
• Singh LR, Kruger WD et al. Functional rescue of mutant human cystathionine beta -synthase by manipulation of Hsp26 Hsp70 levels in saccharomyces cerevisiae. J Biol Chem. 2008-12-12 [PMID: 19074437]
• 1 Ali MY, Whiteman M, Low CM et al. Hydrogen sulphide reduces insulin secretion from HIT-T15 cells by a KATP channel-dependent pathway. J Endocrinol;195(1):105-12. 2007-10-01 [PMID: 17911402]
• Li N, Chen L, Muh RW et al. Hyperhomocysteinemia associated with decreased renal transsulfuration activity in Dahl S Rats. Hypertension 2006-06-01 [PMID: 16636197]

Bioinformatics

• Gene Symbol: CBS
• Entrez:
  • 875(Human)
• OMIM:
  • 236200(Human)
• Uniprot:
  • AAH11381(Human)