BBS9 Antibody - BSA Free

Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BBS9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BBS9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF, WB reported in scientific literature (PMID: 23943788).
• Control Peptide:

  BBS9 Protein (NBP1-88927PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%), Mouse reactivity reported in scientific literature (PMID: 23943788).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BBS9 Antibody - BSA Free

• B1
• Bardet-Biedl syndrome 9 protein
• Bardet-Biedl syndrome 9
• C18
• D1
• Parathyroid hormone-responsive B1 gene protein
• protein PTHB1
• PTHB1MGC118917
• PTH-responsive osteosarcoma B1 protein

Background

The BBS9 gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore, is thought to be involved inparathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternativelyspliced transcript variants

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BBS9 Antibody (NBP1-88927)(3)

Publications using NBP1-88927

• Chamling X, Seo S, Searby CC et al. The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome. PLoS Genet 2014-02-01 [PMID: 24550735]
• Zhang Y, Seo S, Bhattarai S et al. BBS mutations modify phenotypic expression of CEP290-related ciliopathies. Hum Mol Genet 2014-01-01 [PMID: 23943788] (WB, ICC/IF, Mouse)
• Humbert MC, Weihbrecht K, Searby CC et al. ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting. Proc Natl Acad Sci U S A 2012-11-27 [PMID: 23150559]

Bioinformatics

• Gene Symbol: BBS9