Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Analysis in human cerebral cortex and tonsil tissues. Corresponding ATP6V0A1 RNA-seq data are presented for the same tissues.
Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) ...read more
Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Western blot analysis and densitometric quantitation of V0a1 in isolated plasma ...read more
Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebellum shows strong cytoplasmic postivity in cells in granular layer.
Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - In Cln1−/− mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3.(a) Western blot analysis & densitometric ...read more
Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1−/− mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3.(a) Western blot analysis & densitometric quantitation of V0a1 in isolated ...read more
Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - In Cln1−/− mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3.(a) Western blot analysis & densitometric ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Western Blot Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY license.
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
vacuolar proton translocating ATPase 116 kDa subunit A
vacuolar-type H(+)-ATPase 115 kDa subunit
V-ATPase 116 kDa isoform a1
V-ATPase 116 kDa
Vph1
VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
V-type proton ATPase 116 kDa subunit a isoform 1
V-type proton ATPase 116 kDa subunit a
Background
ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Schrag M, Solopova E, Romero-Fernandez W et al. Fatal Iatrogenic Cerebral Amyloid-Related Encephalitis in a patient treated with lecanemab for Alzheimers disease: neuroimaging and neuropathology. Research Square 2023-05-10 (IHC)
Solopova E, Romero-Fernandez W, Harmsen H et al. Fatal Iatrogenic Cerebral Amyloid-Related Encephalitis in a patient treated with lecanemab for Alzheimers disease: neuroimaging and neuropathology medRxiv 2023-04-29 (IHC-P, Human)
IHC-P
Human
Ye C, Zeng P, Liu Y et al. Tau overload associated insufficient lysosomal hydrolysis activity through deacidification of lysosomes Research Square 2023-08-31 (WB, Mouse)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.