Cdk6 Antibody (0O6X7)

Western Blot: Cdk6 Antibody (0O6X7) [NBP3-15249] - Western blot analysis of extracts of various cell lines, using Cdk6 Rabbit mAb (NBP3-15249) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Hu, Rt
• Applications: WB
• Clone: 0O6X7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cdk6 Antibody (0O6X7) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 227-326 of human CDK6 (Q00534). QLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CDK6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cdk6 Antibody (0O6X7)

• Cdk6
• CDKN6
• Cell division protein kinase 6
• cyclin-dependent kinase 6
• EC 2.7.11
• EC 2.7.11.22
• PLSTIREMGC59692
• Serine/threonine-protein kinase PLSTIRE

Background

Cdk6 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK6