ch-TOG Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ch-TOG Antibody [NBP1-85624] - Staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ch-TOG Antibody [NBP1-85624] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ch-TOG Antibody [NBP1-85624] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: ch-TOG Antibody [NBP1-85624] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: ch-TOG Antibody [NBP1-85624] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ch-TOG Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
• Predicted Species: Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKAP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ch-TOG Protein (NBP1-85624PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ch-TOG Antibody - BSA Free

• CHTOG
• Ch-TOG
• Colonic and hepatic tumor over-expressed gene protein
• cytoskeleton associated protein 5
• cytoskeleton-associated protein 5
• EC 2.7.7.6
• EC 3.1.1.29
• KIAA0097FLJ35359
• MSPS
• TOG
• TOGp

Background

ch-TOG, also known as CKAP-5, is a microtubule-associated protein that is involved in microtubule dynamics required for mitotic spindle formation. Specifically, chTOG protects kinetochore microtubules from depolymerization and plays an important role in centrosomal microtubule assembly. ch-TOG is typically overexpressed in tumor cells, may therefore be associated with cancer development.

ch-TOG antibodies are useful tools for cytosleletal research and for some cancer studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKAP5