CHAF1B Antibody - BSA Free

Western Blot: CHAF1B Antibody [NBP1-88235] - Analysis in human cell line MOLT-4.

Immunocytochemistry/Immunofluorescence: CHAF1B Antibody [NBP1-88235] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CHAF1B Antibody [NBP1-88235] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: CHAF1B Antibody [NBP1-88235] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CHAF1B Antibody [NBP1-88235] - Staining of human lymph nodes shows strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: CHAF1B Antibody [NBP1-88235] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHAF1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHAF1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in chromatin immunoprecipitation reported in scientific literature (PMID: 30423293).
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  CHAF1B Protein (NBP1-88235PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHAF1B Antibody - BSA Free

• CAF1
• CAF-1
• CAF1ACAF-1 subunit B
• CAF1P60CAF-I 60 kDa subunit
• CAF-IP60
• chromatin assembly factor 1 subunit B
• chromatin assembly factor 1, subunit B (p60)
• Chromatin assembly factor I p60 subunit
• human chromatin assembly factor-I p60 subunit, 10
• MPHOSPH7CAF-I p60
• MPP7M-phase phosphoprotein 7

Background

Chromatin assembly factor 1 (CAF-1) is a member of the histone chaperone family. It is required for inheritance of epigenetically determined chromosomal states, and in vitro, it promotes the assembly of chromatin during DNA replication and DNA repair. CAF1 is a complex of three subunits; p150, p60, and p48. This complex is localized to the nucleus of human cells. Both the composition and the biochemical activity of CAF-1 are conserved among human, yeast, and Drosophila.

CAF-1 antibodies are useful tools for cell division, DNA replication and DNA packaging.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHAF1B Antibody (NBP1-88235)(2)

Publications using NBP1-88235

• Dreyer J, Ricci G, van den Berg J et Al. Acute multi-level response to defective de novo chromatin assembly in S-phase Mol Cell 2024-11-05 [PMID: 39536749]
• Volk A, Liang K, Suraneni P et al. A CHAF1B-dependent molecular switch in hematopoiesis and leukemia pathogenesis. Cancer cell. 1905-07-10 [PMID: 30423293] (Chemotaxis, Human)

Bioinformatics

• Gene Symbol: CHAF1B
• Entrez:
  • 8208(Human)
• Uniprot:
  • Q13112(Human)