The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to CHI3L1(chitinase 3-like 1 (cartilage glycoprotein-39)) The peptide sequence was selected from the middle region of CHI3L1. Peptide sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHI3L1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for Chitinase 3-like 1/YKL-40 Antibody - BSA Free
AW208766
Brp39
CHI3L1
Chitinase 3 like 1
Chitinase 3-like 1
gp39
HCgp39
YKL-40
Background
CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Publications for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913)(1)
We have publications tested in 1 application: Immunohistochemistry-Frozen.
Filter By Application
Immunohistochemistry-Frozen
(1)
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-57913
Applications
Species
Yao J, Dai S, Zhu R et al. Deciphering molecular heterogeneity and dynamics of neural stem cells in human hippocampal development, aging, and injury bioRxiv 2023-05-16 (Immunohistochemistry-Frozen)
Details: Dilution: 1:200
Immunohistochemistry-Frozen
Reviews for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913) (0)
There are no reviews for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913). (Showing 1 - 1 of 1 FAQ).
Our customer would like to have CHI3L1 antibody for testing samples from dog... After searching, none can be found. However, we noticed that the sequence of NBP1-57913 is listed clearly as well as similarities of other species. We wonder if you can help compare with canine CHI3L1 as well.
We have five antibodies to CHI3L1, all of which are raised against the human protein. The sequence entry of canine CHI3L1 has not been reviewed in Uniprot, however I ran an alignment for you between this and the human sequence, and found the homology to be 82%. Therefore it is likely, but not confirmed, that antibodies which bind the human protein may recognise canine CHI3L1. The homology between the immunogen sequence used to generate NBP1-57913 and the full length canine sequence is 84%. The homology between the immunogen sequence used to generate NBP1-28610 and the full length canine sequence is 83%. Your customer may be interested in our Innovators Reward Program, which allows them to try our primary antibodies in an untested species or application without the financial risk of failure. They could try one of our CHI3L1 antibodies against canine samples, share their results (including an image) with us, and receive a voucher for 100% of the purchase price of the reviewed product.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Chitinase 3-like 1/YKL-40 Antibody - BSA Free and receive a gift card or discount.