Chorionic Gonadotropin beta Chain (hCG beta) Antibody

Immunocytochemistry/Immunofluorescence: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human cerebral cortex shows no positivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Discontinued

Chorionic Gonadotropin beta Chain (hCG beta) Antibody Summary

• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CGB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Chorionic Gonadotropin beta Chain (hCG beta) Antibody

• CGB
• CGB3
• CGB3choriogonadotropin subunit beta
• CGB5
• CGB7
• CGB8
• CG-Beta
• Choriogonadotropin Subunit Beta
• Chorionic gonadotrophin chain beta
• chorionic gonadotropin beta 3 subunit
• Chorionic Gonadotropin beta Chain
• chorionic gonadotropin beta subunit
• chorionic gonadotropin, beta polypeptide
• hCGB

Background

Human chorionic gonadotropin (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is stimulated to produce progesterone which in turn maintains the secretory endometrium. hCG is present only in trace amounts in non pregnant urine and sera. It rises sharply during pregnancy. HCG is composed of two non identical, non covalently linked polypeptide chains designated as the a and b subunits. The a subunit of HCG is nearly identical to that of thyroid stimulating hormone (TSH), follicle stimulating hormone (FSH) and luteinizing hormone (LH). A germ cell tumor which is positive for cytokeratin, placental alkaline phosphatase (PLAP) and HCG but negative for EMA and AFP is probably a choriocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CGB3