PLOD1 Antibody - BSA Free

Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.

Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.

Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY license.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLOD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLOD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin Reported in scientific literature (PMID:34400365)
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  PLOD1 Protein (NBP2-38770PEP)

  Loading...

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27119146). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLOD1 Antibody - BSA Free

• 2-oxoglutarate 5-dioxygenase 1
• EC 1.14.11.4
• Ehlers-Danlos syndrome type VI)
• FLJ42041
• LH1
• LLH
• lysine hydroxylase
• Lysyl hydroxylase 1
• PLODLH
• procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase
• procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
• procollagen-lysine
• procollagen-lysine, 2-oxoglutarate 5-dioxygenase

Background

Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLOD1 Antibody (NBP2-38770)(3)

Publications using NBP2-38770

• Koenig SN, Cavus O, Williams J Et al. New mechanistic insights to PLOD1-mediated human vascular disease Translational research : the journal of laboratory and clinical medicine 2021-08-13 [PMID: 34400365] (WB, IHC-P, Human)
• Jover E, Silvente A, Marin F et al. Inhibition of enzymes involved in collagen cross-linking reduces vascular smooth muscle cell calcification. FASEB J. 2018-03-16 [PMID: 29547702] (Human)
• Heard ME, Besio R, Weis M et al. Sc65-Null Mice Provide Evidence for a Novel Endoplasmic Reticulum Complex Regulating Collagen Lysyl Hydroxylation. PLoS Genet. 2016-04-01 [PMID: 27119146] (WB, Mouse)

Bioinformatics

• Gene Symbol: PLOD1
• Uniprot:
  • Q02809(Human)