DBT Antibody - BSA Free

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Analysis in human kidney and pancreas tissues. Corresponding DBT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon, liver, lymph node and pancreas using Anti-DBT antibody NBP1-89522 (A) shows similar protein distribution across tissues to independent antibody NBP1-85964 (B).

Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.

Western Blot: DBT Antibody [NBP1-89522] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human liver.

Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DBT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DBT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DBT Protein (NBP1-89522PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DBT Antibody - BSA Free

• BCATE2BCKAD E2 subunit
• BCKADE2
• BCKAD-E2
• branched chain acyltransferase, E2 component
• Branched-chain alpha-keto acid dehydrogenase complex component E2
• Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex
• dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease)
• dihydrolipoamide branched chain transacylase E2
• Dihydrolipoamide branched chain transacylase
• dihydrolipoyl transacylase
• Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
• E2 component of branched chain alpha-keto acid dehydrogenase complex
• E2
• E2B
• EC 2.3.1.168
• lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial
• lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex
• MGC9061
• mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)

Background

The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DBT