Claudin-4 Antibody (4A11) - Azide and BSA Free

Immunoprecipitation: Claudin-4 Antibody (4A11) [H00001364-M02] - Analysis of CLDN4 transfected lysate using anti-CLDN4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN4 MaxPab mouse polyclonal antibody.

Sandwich ELISA: Claudin-4 Antibody (4A11) [H00001364-M02] - Detection limit for recombinant GST tagged CLDN4 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, IP
• Clone: 4A11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Claudin-4 Antibody (4A11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CLDN4 (NP_001296, 29 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ
• Specificity: CLDN4 - claudin 4 (4A11)
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CLDN4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
• Application Notes: Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Claudin-4 Antibody (4A11) - Azide and BSA Free

• claudin 4
• Claudin4
• Claudin-4
• CLDN4
• Clostridium perfringens enterotoxin receptor 1
• Clostridium perfringens enterotoxin receptor
• CPE-R
• CPE-RCPETR
• CPE-receptor
• CPETR1
• hCPE-R
• WBSCR8
• WBSCR8CPERCPETR1claudin-4
• Williams-Beuren syndrome chromosomal region 8 protein

Background

This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Claudin-4 Antibody (H00001364-M02)(1)

Publication using H00001364-M02

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: CLDN4
• Entrez:
  • 1364(Human)
• Uniprot:
  • NP_001296()