Tight Junction Protein 1 Antibody - BSA Free

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.

Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.

Immunohistochemistry: Tight Junction Protein 1 Antibody [NBP1-85047] - Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. Left image FH-i, right image Corr-FH-iHeps. All images were taken with 10x objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) and analyzed with ImageJ software. Image collected and cropped by CiteAb from the following publication (//stemcellres.biomedcentral.com/articles/10.1186/s13287-019-1342-6) licensed under a CC-BY license.

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control and 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following publication (//jasbsci.biomedcentral.com/articles/10.1186/s40104-020-00449-y) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in control (vector only transfected HEK293T lysate) and TJP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - The primary mouse lung endothelial cells were fixed, permeabilized and stained with 1:100 diluted anti-ZO-1 ab for overnight. Samples were washed and subsequently incubated with 1:500 diluted Alexa Fuor 546 at room temperature for 1 hour. ICC/iF image submitted by a verified customer reveiw.

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Monolayer of Human ARPE-19 cells on a glass substrate. Tight Junction Protein 1 staining in red. ICC/IF image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot analysis of function protein expression on primary human renal cortical epithelial cells challenged with cytokines. Primary human renal tubular epithelial cells are challenged with cytokine cocktail (15nM IFN gamma , 6nM TNF alpha , & 3nM IL1 beta ). (A, B) Expression of Snail, E-Cad, TJP1, SMA. AhR, IDO, KMO, KY, MHCI & II. (C, D) Densitometric quantitation of protein in (A, B). All Western blots are representative of at least three independent experiments. *P < 0.05, ***P < 0.0001 versus to cells without treatment, analysis is multiple t-tests, pairwise comparison of individual time-point to control indicated same p-value. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. b The relative expression of occludin in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. c The relative expression of claudin-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32391146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Differentiation of FH- & corr-FH-iPSCs into hepatocytes. a Representative pictures of cell morphology & immunostainings of the indicated markers at day 25 of differentiation. Scale bars: 50 μm. b Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. All images were taken with × 10 objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) & analyzed with ImageJ software. Arrowheads indicate bile canaliculi Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31358055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma , 6 nM TNF alpha , & 3 nM IL1 beta ) for 24 h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma , 6 nM TNF alpha , & 3 nM IL1 beta ) for 24 h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt, Po
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tight Junction Protein 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
• Marker: Intercellular Junctions/Tight Junction Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TJP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in HeLa, separated by Size, antibody dilution of 1:20, apparent MW was 257 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  Tight Junction Protein 1 Protein (NBP1-85047PEP)

Reactivity Notes

Porcine and mouse reactivity reported from verified customer reviews.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tight Junction Protein 1 Antibody - BSA Free

• DKFZp686M05161
• MGC133289
• tight junction protein 1 (zona occludens 1)
• Tight junction protein 1
• tight junction protein ZO-1
• TJP1
• ZO1
• ZO-1
• zona occludens 1
• Zona occludens protein 1
• zonula occludens 1 protein
• Zonula occludens protein 1

Background

Members of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-1, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-1 is a peripheral membrane protein bound on the cytoplasmic surface of junctional contacts and is expressed in all tight junctions regardless of their properties. ZO-1 immunoprecipitates with its family member ZO-2. ZO-1 was shown to undergo tyrosine phosphorylation during tight junction formation and remodeling. Two different isoforms of ZO-1, alpha-minus and alpha-plus, have been described, which result from alternative splicing of an mRNA encoded by a single gene. The ZO-1 alpha-plus contains an 80 amino acids motif called alpha which is not present in ZO-1 alpha-minus. The alpha-containing isoform is found in most epithelial cell junctions. The short isoform (ZO-1 alpha-minus) is found both in endothelial cells and the highly specialized epithelial junctions of renal glomeruli and Sertoli cells of the seminiferous tubules. This difference in distribution provides molecular distinction among tight junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tight Junction Protein 1 Antibody (NBP1-85047)(15)

Publications using NBP1-85047

• Rion J Wendland, Budd A Tucker, Kristan S Worthington Influence of Substrate Stiffness on iPSC-Derived Retinal Pigmented Epithelial Cells Stem Cells Translational Medicine 2024-06-01 [PMID: 38560893]
• Cheng Y, Li J, Zhang X et al. Protective Effect of Qingchang Wenzhong Decoction on Colitis and Colitis-Related Carcinogenesis by Regulating Inflammation and Intestinal Fibrosis Journal of inflammation research 2023-04-07 [PMID: 37056910] (IHC-P, Mouse)
• Fu Q, Lin Q, Chen D et al. beta-defensin 118 attenuates inflammation and injury of intestinal epithelial cells upon enterotoxigenic Escherichia coli challenge BMC veterinary research 2022-04-19 [PMID: 35440001] (WB, ICC/IF)
• Song K, Zeng X, Xie X et al. Dl-3-n-butylphthalide attenuates brain injury caused by cortical infarction accompanied by cranial venous drainage disturbance Stroke and vascular neurology 2022-01-31 [PMID: 35101948] (WB, Rat)
• Manon Boul, Nassima Benzoubir, Antonietta Messina, Rasta Ghasemi, Ismail Ben Mosbah, Jean-Charles Duclos-Vallée, Anne Dubart-Kupperschmitt, Bruno Le Pioufle A versatile microfluidic tool for the 3D culture of HepaRG cells seeded at various stages of differentiation Scientific Reports 2021-07-07 [PMID: 34234159]
• Abbassi L, El-Hayek S, Carvalho KF et al. Epidermal growth factor receptor signaling uncouples germ cells from the somatic follicular compartment at ovulation Nature communications 2021-03-04 [PMID: 33664246] (ICC/IF, Mouse)
• Hahn L, Helmrich N, Herebian D et al. IL-13 as Target to Reduce Cholestasis and Dysbiosis in Abcb4 Knockout Mice Cells 2020-08-24 [PMID: 32846954]
• Liu X, Zhang B, Liu H et al. Determination of the available energy values and amino acid digestibility of Flammulina velutipes stem waste and its effects on carcass trait and meat quality fed to growing-finishing pigs J Anim Sci Biotechnol 2020-05-04 [PMID: 32391146] (WB)
• Caron Jerome, Pene Veronique, Tolosa Laia et al. Low-density lipoprotein receptor-deficient hepatocytes differentiated from induced pluripotent stem cells allow familial hypercholesterolemia modeling, CRISPR/Cas-mediated genetic correction, and productive hepatitis C virus infection. Stem Cell Research & Therapy 2019-07-29 [PMID: 31358055] (ICC/IF)
• Coffin KM, Liu J, Warren TK et al. Persistent Marburg Virus Infection in the Testes of Nonhuman Primate Survivors. Cell Host Microbe 2018-09-12 [PMID: 30173956] (ICC/IF, Human)
• Liu M, Yang J, Zhang Y et al. ZIP4 Promotes Pancreatic Cancer Progression by Repressing ZO-1 and claudin-1 through a ZEB1-Dependent Transcriptional Mechanism. Clin. Cancer Res. 2018-04-03 [PMID: 29615456] (Human)
• McIntyre BA, Alev C, Mechael R et al. Expansive Generation of Functional Airway Epithelium From Human Embryonic Stem Cells. Stem Cells Transl Med 2014-01-01 [PMID: 24300555] (IF/IHC, Human)
• Lassiter R, Merchen Td, Fang X, Wang Y Protective Role of Kynurenine 3-Monooxygenase in Allograft Rejection and Tubular Injury in Kidney Transplantation Frontiers in immunology 2021-07-07 [PMID: 34305900] (IHC-P)
• Chen Y, Tristan CA, Lu C et al. A Versatile Polypharmacology Platform Promotes Cytoprotection and Viability of Human Pluripotent and Differentiated Cells Nat Methods 2021-05-04 [PMID: 33941937] (Simple Western)

Reviews for Tight Junction Protein 1 Antibody (NBP1-85047) (5)

Average Rating: 4.6

(Based on 5 reviews)

We have 5 reviews tested in 4 species: Human, Mouse, Rat, Other.

reviewed by: James Xiao ICC Rat 12/10/2020

Summary

• Application: Immunocytochemistry
• Sample Tested: Epithelial cells
• Species: Rat
• Lot: 000001836

reviewed by: Fabio Marongiu ICC Human 08/29/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: ARPE-19 cells
• Species: Human
• Lot: C105864

Comments

• Comments: Fixative 4% PFA
  Blocking Goat Serum
  Dilution 1:200
  Incubation 1h @ RT

reviewed by: James Xiao WB Mouse 06/22/2017

Summary

• Application: Western Blot
• Sample Tested: Primary Mouse Lung cells
• Species: Mouse

reviewed by: James Xiao ICC/IF Mouse 10/13/2016

Summary

• Application: Other
• Sample Tested: Primary mouse lung endotelial cells
• Species: Mouse
• Lot: B10562

reviewed by: Verified Customer ICC Other 02/02/2016

Summary

• Application: Immunocytochemistry
• Sample Tested: Pig trabecular meshwork cells
• Species: Other

Bioinformatics

• Gene Symbol: TJP1