Collagen X alpha 1 Antibody (0F5Q9)

Western Blot: Collagen X alpha 1 Antibody (0F5Q9) [NBP3-15419] - Western blot analysis of extracts of various cell lines, using Collagen X alpha 1 Rabbit mAb (NBP3-15419) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Mu, Rt
• Applications: WB
• Clone: 0F5Q9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Collagen X alpha 1 Antibody (0F5Q9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X alpha 1 (Q03692). HSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: COL10A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Collagen X alpha 1 Antibody (0F5Q9)

• COL10A1
• Collagen Alpha-1(X) Chain
• Collagen X, Alpha-1 Polypeptide
• Schmid Metaphyseal Chondrodysplasia

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL10A1