CPT1A Antibody - BSA Free

Western Blot: CPT1A Antibody [NBP1-59608] - Lanes: 1. 45ug capan1 cell lysate 2. 45 ug HPAF cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: CPT1A.

Western Blot: CPT1A Antibody [NBP1-59608] - 293T cells lysate, concentration 0.2-1 ug/ml.

Western Blot: CPT1A Antibody [NBP1-59608] - Sample Tissue: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CPT1A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CPT1A(carnitine palmitoyltransferase 1A (liver)) The peptide sequence was selected from the middle region of CPT1A (NP_001027017). Peptide sequence LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPT1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:300
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 86 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CPT1A Antibody - BSA Free

• carnitine O-palmitoyltransferase 1, liver isoform
• Carnitine O-palmitoyltransferase I, liver isoform
• carnitine palmitoyltransferase 1A (liver)
• Carnitine palmitoyltransferase 1A
• carnitine palmitoyltransferase I, liver
• CPT I
• CPT1
• CPT1A
• CPT1-L
• CPT1-LEC 2.3.1.21
• CPTI-L
• EC 2.3.1
• EC 2.3.1.21
• L-CPT1

Background

The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPT1A Antibody (NBP1-59608)(1)

Publication using NBP1-59608

• Wei Sun, Tao Nie, Kuai Li, Wenjie Wu, Qiaoyun Long, Tianshi Feng, Liufeng Mao, Yuan Gao, Qing Liu, Xuefei Gao, Dewei Ye, Kaixuan Yan, Ping Gu, Yong Xu, Xuemei Zhao, Kang Chen, Kerry Martin Loomes, Shaoqiang Lin, Donghai Wu, Xiaoyan Hui Hepatic CPT1A Facilitates Liver-Adipose Cross-Talk via Induction of FGF21 in Mice. Diabetes 2021-10-21 [PMID: 34675003]

Bioinformatics

• Gene Symbol: CPT1A
• Entrez:
  • 1374(Human)
• Uniprot:
  • P50416(Human)