CPT1B Antibody - BSA Free

Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color

Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color

Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200

Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Western Blot: CPT1B Antibody [NBP1-59576] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CPT1B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPT1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:300
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31013835).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CPT1B Antibody - BSA Free

• carnitine O-palmitoyltransferase 1, muscle isoform
• carnitine O-palmitoyltransferase I, mitochondrial muscle isoform
• Carnitine O-palmitoyltransferase I, muscle isoform
• carnitine palmitoyltransferase 1B (muscle)
• Carnitine palmitoyltransferase 1B
• Carnitine palmitoyltransferase I-like protein
• CPT I
• CPT1B
• CPT1M
• CPT1-M
• CPT1-MMCCPT1
• CPTI
• CPTI-M
• EC 2.3.1
• EC 2.3.1.21
• FLJ55729
• FLJ58750
• KIAA1670
• MCPT1
• M-CPT1

Background

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPT1B Antibody (NBP1-59576)(6)

Publications using NBP1-59576

• de Souza SLB, Mota GAF, da Silva VL et al. Effects of early exercise on cardiac function and lipid metabolism pathway in heart failure J Cell Mol Med 2023-08-31 [PMID: 37654004] (Western Blot, Human)
• Zhang F, Liu L, Xie Y et al. Cardiac contractility modulation ameliorates myocardial metabolic remodeling in a rabbit model of chronic heart failure through activation of AMPK and PPAR-? pathway Open Med (Wars) 2022-02-22 [PMID: 35799598] (Western Blot, Human)
• Pellegrin M, BouzourEne K, Aubert JF et al. Impact of aerobic exercise type on blood flow, muscle energy metabolism, and mitochondrial biogenesis in experimental lower extremity artery disease Sci Rep 2020-08-20 [PMID: 32820213] (WB, Mouse)
• Chacinska, M;Zabielski, P;Ksiazek, M;Szataj, P;Jarzabek, K;Kojta, I;Chabowski, A;Btachnio-Zabielska, AU; The Impact of OMEGA-3 Fatty Acids Supplementation on Insulin Resistance and Content of Adipocytokines and Biologically Active Lipids in Adipose Tissue of High-Fat Diet Fed Rats Nutrients 2019-04-12 [PMID: 31013835] (WB, Rat)
• de Toledo Frias F, Rocha KCE, de Mendonca M et al. Fenofibrate Reverses Changes Induced By High-Fat Diet On Metabolism In Mice Muscle And Visceral Adipocytes J. Cell. Physiol. 2017-09-19 [PMID: 28926107] (Mouse)
• Brittain EL, Talati M, Fessel JP et al. Fatty Acid Metabolic Defects and Right Ventricular Lipotoxicity in Human Pulmonary Arterial Hypertension. Circulation 2016-05-17 [PMID: 27006481] (WB, Human)
  
  Details:
  The Novus CPT1B antibody was used in western blotting of human tissue homogenates

Bioinformatics

• Gene Symbol: CPT1B
• Entrez:
  • 1375(Human)
• Uniprot:
  • Q92523(Human)