DC-STAMP/TM7SF4 Antibody - BSA Free

Western Blot: DC-STAMP/TM7SF4 Antibody [NBP1-79329] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DC-STAMP/TM7SF4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCSTAMP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33479228)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DC-STAMP/TM7SF4 Antibody - BSA Free

• DCSTAMP
• DC-STAMP
• dendritic cell-specific transmembrane protein
• FIND
• IL-4-induced Protein
• TM7SF4
• transmembrane 7 superfamily member 4

Background

Dendritic cells are unique in their ability to present antigen to naive T cells, and therefore play a central role inthe initiation of immune responses. The protein encoded by this gene is a transmembrane molecule that ispreferentially expressed by dendritic cells. Its expression is down-regulated by ligation of the CD40 molecule.Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of someof these variants has not been determined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DC-STAMP/TM7SF4 Antibody (NBP1-79329)(1)

Publication using NBP1-79329

• Place DE, Malireddi RKS, Kim J, et al. Osteoclast fusion and bone loss are restricted by interferon inducible guanylate binding proteins Nature communications 2021-01-21 [PMID: 33479228] (WB, Mouse)

Bioinformatics

• Gene Symbol: DCSTAMP
• Uniprot:
  • NP_110415()