Dermokine beta Antibody - BSA Free

Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dermokine beta Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Dermokine beta using the following amino acid sequence: STGTNIGEALGHGLGDALSEGVGKAIGKEAGGAAGSKVSEALGQGTREAVGTGVRQVPGFGAADALGNRVGEAAHALGNTGHEIGRQAEDVIRHGADAVRGSWQGVPGHNGAWETSGGHGIFGSQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMKN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dermokine beta Antibody - BSA Free

• dermokine
• Epidermis-specific secreted protein SK30/SK89
• FLJ79374
• UNQ729
• ZD52F10

Background

This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain compliments. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, but the full-length nature of some of them has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMKN