DNA Ligase III Antibody - BSA Free

Western Blot: DNA Ligase III Antibody [NBP2-92719] - Analysis of extracts of various cell lines, using at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: DNA Ligase III Antibody [NBP2-92719] - Analysis of PC-12 cells using LIG3 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: DNA Ligase III Antibody [NBP2-92719] - Analysis of NIH/3T3 cells using LIG3 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Rat liver using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: DNA Ligase III Antibody - Azide and BSA Free [NBP2-92719] - Immunohistochemistry analysis of paraffin-embedded Rat brain using DNA Ligase III Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNA Ligase III Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 254-460 of human DNA Ligase III (NP_039269.2). CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIG3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 113 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNA Ligase III Antibody - BSA Free

• DNA ligase 3
• DNA Ligase III
• EC 6.5.1.1
• LIG2
• LIG3
• ligase II, DNA, ATP-dependent
• ligase III, DNA, ATP-dependent
• Polydeoxyribonucleotide synthase [ATP] 3

Background

DNA Ligase III is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LIG3