DONSON Antibody - BSA Free

Western Blot: DONSON Antibody [NBP1-70752] - Middle region validated by WB using Mouse brains at 1:1000.

Western Blot: DONSON Antibody [NBP1-70752] - Human LCL and mouse brains incubated for 5 minutes in CDP-Star for 5 minutes, Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DONSON Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DONSON(downstream neighbor of SON) The peptide sequence was selected from the middle region of DONSON. Peptide sequence DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DONSON
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DONSON Antibody - BSA Free

• B17
• downstream neighbor of SON
• protein downstream neighbor of Son

Background

This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DONSON