Dynorphin Antibody

Immunohistochemistry-Paraffin: Dynorphin Antibody [NBP2-48948] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Discontinued

Dynorphin Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSLEEKLRGLSDGFREGAESELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGEGDGDSMGHEDLYKRYGGFLRRIRPKLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDYN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dynorphin Antibody

• ADCA
• Beta-neoendorphin-dynorphin
• leu-enkephalin
• leumorphin
• MGC26418
• PENKB
• preprodynorphin
• preproenkephalin B
• prodynorphin
• proenkephalin-B
• rimorphin
• SCA23
• spinocerebellar ataxia 23

Background

The protein encoded by the Dynorphin gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDYN